Cannabinoid R1/CB1/CNR1 Antibody (1F9), 0.1 mg

0
28


Price: [price_with_discount]


[ad_1]
Description: The Cannabinoid R1 / CB1 / CNR1 Antibody (1F9) from Novus is a mouse monoclonal antibody to Cannabinoid R1 / CB1 / CNR1. This antibody reacts with human, rat. The Cannabinoid R1 / CB1 / CNR1 Antibody (1F9) has been validated for the following applications: Western Blot, ELISA.
Size: 0.1 mg
Species Reactivity: Human, Rat
Host: Mouse Monoclonal
Clone: 1F9
Isotype: IgG2a Kappa
Conjugate: Unconjugated
Immunogen: CNR1 (NP_057167, 1 a.a. – 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMV
Applications: Western Blot, ELISA



[ad_2]

LEAVE A REPLY

Please enter your comment!
Please enter your name here